PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG001200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28233.1 Da    PI: 9.5097
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG001200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.99.7e-32959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtfskRrng+lKKA+E+SvLCdaevavi+fs++gklyey++
  Pavir.2KG001200.2.p  9 KRIENKINRQVTFSKRRNGLLKKANEISVLCDAEVAVIVFSPKGKLYEYAT 59
                         79***********************************************86 PP

2K-box85.98.2e-2982163889
                K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                          s+e + + ++++e++kLk++i ++q+ ++hl+GedLesL+lkeLqqLeqqLe+slk+iRs+K++ l e+ + lqk   + q+
  Pavir.2KG001200.2.p  82 SAEPESEVNWCHEYRKLKAKIGTIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIRSRKERSLQEENKALQKELADRQK 163
                          555667789*****************************************************************98777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.842161IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-42160IPR002100Transcription factor, MADS-box
CDDcd002657.31E-42276No hitNo description
SuperFamilySSF554551.7E-34291IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.2E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-313859IPR002100Transcription factor, MADS-box
PfamPF014864.5E-2287162IPR002487Transcription factor, K-box
PROSITE profilePS5129713.28188179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KANEISVLCD AEVAVIVFSP KGKLYEYATD  60
DRMDKILERY ECYSYAEKAL ISAEPESEVN WCHEYRKLKA KIGTIQKCHK HLMGEDLESL  120
NLKELQQLEQ QLESSLKHIR SRKERSLQEE NKALQKELAD RQKAAASRPQ VQWDPHTQAQ  180
TSSSSSSFLM RQDQQPLQPP QNIWYPPVTG ERGEEAAAVA QRQPGQAQPQ LRIGSLPPWM  240
TSHLNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q4e-22174173Myocyte-specific enhancer factor 2B
1tqe_R4e-22174173Myocyte-specific enhancer factor 2B
1tqe_S4e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.159100.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9598850.0EU959885.1 Zea mays clone 220235 mRNA sequence.
GenBankEU9630610.0EU963061.1 Zea mays clone 257029 MADS-box transcription factor 15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105333.21e-129zea apetala homolog 1
SwissprotQ6Q9I21e-113MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBLB6TDJ61e-134B6TDJ6_MAIZE; MADS-box transcription factor 15
STRINGGRMZM2G148693_P021e-115(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.18e-59MIKC_MADS family protein